NEK7 anticorps

N° du produit ABIN630802

Détail du produit anti-NEK7 anticorps

Antigène: NEK7

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NEK7 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: NEK7 antibody was raised using a synthetic peptide corresponding to a region with amino acids KARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NEK7 Blocking Peptide, catalog no. 33R-4257, is also available for use as a blocking control in assays to test for specificity of this NEK7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEK7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NEK7

Antigène: NEK7

Autre désignation: NEK7 (NEK7 Produits)

Synonymes: anticorps 2810460C19Rik, anticorps AU020186, anticorps wu:fj68f02, anticorps zgc:100962, anticorps zgc:92175, anticorps AtNek7, anticorps NIMA-related kinase 7, anticorps NIMA (never in mitosis gene a)-related expressed kinase 7, anticorps NIMA-related kinase 7, anticorps NIMA related kinase 7, anticorps NIMA-related kinase 7 S homeolog, anticorps Nek7, anticorps nek7, anticorps NEK7, anticorps nek7.S

Sujet: NIMA-related kinases share high amino acid sequence identity with the gene product of the Aspergillus nidulans 'never in mitosis A' gene, which controls initiation of mitosis.

Poids moléculaire: 34 kDa (MW of target protein)

Pathways: Inflammasome