Fibronectin 1 anticorps (C-Term)

N° du produit ABIN630804

Cet anticorps anti-Fibronectin 1 est un anticorps Lapin Polyclonal détectant Fibronectin 1 dans WB. Adapté pour Humain et Chien.

Aperçu rapide pour Fibronectin 1 anticorps (C-Term) (ABIN630804)

Antigène: Fibronectin 1 (FN1)

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Fibronectin 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Fibronectin 1 anticorps

Épitope: C-Term

Specificité: Fibronectin 1 antibody was raised against the C terminal of FN1

Purification: Affinity purified

Immunogène: Fibronectin 1 antibody was raised using the C terminal of FN1 corresponding to a region with amino acids NCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADR

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Fibronectin 1 Blocking Peptide, (ABIN5613589), is also available for use as a blocking control in assays to test for specificity of this Fibronectin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Fibronectin 1

Antigène: Fibronectin 1 (FN1)

Autre désignation: Fibronectin 1

Sujet: FN1 is a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis.

Poids moléculaire: 76 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Autophagy