Fibronectin 1 anticorps (C-Term)
-
- Antigène Voir toutes Fibronectin 1 (FN1) Anticorps
- Fibronectin 1 (FN1)
-
Épitope
- C-Term
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Fibronectin 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Fibronectin 1 antibody was raised against the C terminal of FN1
- Purification
- Affinity purified
- Immunogène
- Fibronectin 1 antibody was raised using the C terminal of FN1 corresponding to a region with amino acids NCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADR
- Top Product
- Discover our top product FN1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Fibronectin 1 Blocking Peptide, catalog no. 33R-6655, is also available for use as a blocking control in assays to test for specificity of this Fibronectin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Fibronectin 1 (FN1)
- Autre désignation
- Fibronectin 1 (FN1 Produits)
- Synonymes
- anticorps FN1, anticorps FN, anticorps cig, anticorps fibronectin, anticorps finc, anticorps lets, anticorps msf, anticorps Fn, anticorps fn2, anticorps fb80d10, anticorps wu:fb80d10, anticorps CIG, anticorps ED-B, anticorps FINC, anticorps FNZ, anticorps GFND, anticorps GFND2, anticorps LETS, anticorps MSF, anticorps E330027I09, anticorps Fn-1, anticorps FIBNEC, anticorps fn-1, anticorps fibronectin 1, anticorps fibronectin 1a, anticorps fibronectin 1 S homeolog, anticorps FN1, anticorps fn1, anticorps fn1a, anticorps Fn1, anticorps fn1.S
- Sujet
- FN1 is a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis.
- Poids moléculaire
- 76 kDa (MW of target protein)
- Pathways
- Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Autophagy
-