DAAM1 anticorps (Middle Region)

N° du produit ABIN630809

L’anticorps Lapin Polyclonal anti-DAAM1 a été validé pour WB. Il convient pour détecter DAAM1 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour DAAM1 anticorps (Middle Region) (ABIN630809)

Antigène: DAAM1 (Dishevelled Associated Activator of Morphogenesis 1 (DAAM1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DAAM1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DAAM1 anticorps

Épitope: Middle Region

Specificité: DAAM1 antibody was raised against the middle region of DAAM1

Purification: Affinity purified

Immunogène: DAAM1 antibody was raised using the middle region of DAAM1 corresponding to a region with amino acids GNTVQYWLLLDRIIQQIVIQNDKGQDPDSTPLENFNIKNVVRMLVNENEV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DAAM1 Blocking Peptide, (ABIN938846), is also available for use as a blocking control in assays to test for specificity of this DAAM1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAAM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DAAM1

Antigène: DAAM1 (Dishevelled Associated Activator of Morphogenesis 1 (DAAM1))

Autre désignation: DAAM1

Sujet: The protein encoded by this gene contains FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein.

Poids moléculaire: 123 kDa (MW of target protein)

Pathways: Signalisation WNT