HAL anticorps (N-Term)

N° du produit ABIN630816

Cet anticorps anti-HAL est un anticorps Lapin Polyclonal détectant HAL dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour HAL anticorps (N-Term) (ABIN630816)

Antigène: HAL (Histidine Ammonia-Lyase (HAL))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HAL est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HAL anticorps

Épitope: N-Term

Specificité: HAL antibody was raised against the N terminal of HAL

Purification: Affinity purified

Immunogène: HAL antibody was raised using the N terminal of HAL corresponding to a region with amino acids INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HAL Blocking Peptide, (ABIN939461), is also available for use as a blocking control in assays to test for specificity of this HAL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HAL

Antigène: HAL (Histidine Ammonia-Lyase (HAL))

Autre désignation: HAL

Sujet: HAL is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. HAL defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids.

Poids moléculaire: 72 kDa (MW of target protein)