LIAS anticorps (C-Term)

N° du produit ABIN630828

Détail du produit anti-LIAS anticorps

Antigène: LIAS (Lipoic Acid Synthetase (LIAS))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LIAS est non-conjugé

Application: Western Blotting (WB)

Specificité: LIAS antibody was raised against the C terminal of LIAS

Purification: Affinity purified

Immunogène: LIAS antibody was raised using the C terminal of LIAS corresponding to a region with amino acids EYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTK

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LIAS Blocking Peptide, catalog no. 33R-2822, is also available for use as a blocking control in assays to test for specificity of this LIAS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIAS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LIAS

Antigène: LIAS (Lipoic Acid Synthetase (LIAS))

Autre désignation: LIAS (LIAS Produits)

Sujet: LIAS belongs to the biotin and lipoic acid synthetases family. It localizes in mitochondrion and plays an important role in alpha-(+)-lipoic acid synthesis. It may also function in the sulfur insertion chemistry in lipoate biosynthesis.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Tube Formation