NCAPH2 anticorps (N-Term)
-
- Antigène Voir toutes NCAPH2 Anticorps
- NCAPH2 (Non-SMC Condensin II Complex, Subunit H2 (NCAPH2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NCAPH2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NCAPH2 antibody was raised against the N terminal of NCAPH2
- Purification
- Affinity purified
- Immunogène
- NCAPH2 antibody was raised using the N terminal of NCAPH2 corresponding to a region with amino acids SGVPQEAENEFLSLDDFPDSRTNVDLKNDQTPSEVLIIPLLPMALVAPDE
- Top Product
- Discover our top product NCAPH2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NCAPH2 Blocking Peptide, catalog no. 33R-8502, is also available for use as a blocking control in assays to test for specificity of this NCAPH2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAPH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NCAPH2 (Non-SMC Condensin II Complex, Subunit H2 (NCAPH2))
- Autre désignation
- NCAPH2 (NCAPH2 Produits)
- Synonymes
- anticorps MGC81656, anticorps CAPH2, anticorps si:dkey-202b22.2, anticorps non-SMC condensin II complex subunit H2, anticorps non-SMC condensin II complex subunit H2 L homeolog, anticorps non-SMC condensin II complex, subunit H2, anticorps NCAPH2, anticorps ncaph2.L, anticorps ncaph2, anticorps Ncaph2
- Sujet
- Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 and SMC4, but they contain different sets of non-SMC subunits. NCAPH2 is 1 of 3 non-SMC subunits that define condensin II.
- Poids moléculaire
- 68 kDa (MW of target protein)
-