HSPA4 anticorps (Middle Region)

N° du produit ABIN630854

L’anticorps Lapin Polyclonal anti-HSPA4 a été validé pour WB. Il convient pour détecter HSPA4 dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour HSPA4 anticorps (Middle Region) (ABIN630854)

Antigène: HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSPA4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HSPA4 anticorps

Épitope: Middle Region

Specificité: HSPA4 antibody was raised against the middle region of HSPA4

Purification: Affinity purified

Immunogène: HSPA4 antibody was raised using the middle region of HSPA4 corresponding to a region with amino acids PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HSPA4 Blocking Peptide, (ABIN5614099), is also available for use as a blocking control in assays to test for specificity of this HSPA4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HSPA4

Antigène: HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))

Autre désignation: HSPA4

Sujet: HSPA4(Hsp70) belongs to the heat shock protein 70 family. It was isolated as a putative Rictor interacting protein and interaction with membranes acts as a platform for its release into the extracellular environment during its recovery from stress. Hsp70 gene expression in Rheumatoid Arthitis-affected synovial tissue is followed by Hsp70 cell surface expression on fibroblast-like synovial cells growing from RA synovial tissue. Serum Hsp70 levels were increased in Systemic sclerosis patients, and associated with pulmonary fibrosis, skin sclerosis, renal vascular damage, oxidative stress, and inflammation.

Poids moléculaire: 94 kDa (MW of target protein)