HSPA4 anticorps (Middle Region)

N° du produit ABIN630854

Détail du produit anti-HSPA4 anticorps

Antigène: HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSPA4 est non-conjugé

Application: Western Blotting (WB)

Specificité: HSPA4 antibody was raised against the middle region of HSPA4

Purification: Affinity purified

Immunogène: HSPA4 antibody was raised using the middle region of HSPA4 corresponding to a region with amino acids PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HSPA4 Blocking Peptide, catalog no. 33R-7155, is also available for use as a blocking control in assays to test for specificity of this HSPA4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HSPA4

Antigène: HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))

Autre désignation: HSPA4 (HSPA4 Produits)

Synonymes: anticorps APG-2, anticorps HS24/P52, anticorps HSPH2, anticorps RY, anticorps hsp70, anticorps hsp70RY, anticorps Hsp110, anticorps Hsp70, anticorps irp94, anticorps 70kDa, anticorps AI317151, anticorps Hsp70RY, anticorps mKIAA4025, anticorps hspa4, anticorps wu:fi30e11, anticorps zgc:55743, anticorps zgc:77413, anticorps hs24/p52, anticorps hspa4-a, anticorps osp94, anticorps pg-2, anticorps hspa4l, anticorps wu:fc41d05, anticorps wu:fi59h02, anticorps wu:fj35c08, anticorps zgc:55506, anticorps heat shock protein family A (Hsp70) member 4, anticorps heat shock protein family A member 4, anticorps heat shock protein 4, anticorps heat shock protein 4b, anticorps heat shock protein family A (Hsp70) member 4 S homeolog, anticorps heat shock protein 4a, anticorps HSPA4, anticorps Hspa4, anticorps hspa4b, anticorps hspa4.S, anticorps hspa4a

Sujet: HSPA4(Hsp70) belongs to the heat shock protein 70 family. It was isolated as a putative Rictor interacting protein and interaction with membranes acts as a platform for its release into the extracellular environment during its recovery from stress. Hsp70 gene expression in Rheumatoid Arthitis-affected synovial tissue is followed by Hsp70 cell surface expression on fibroblast-like synovial cells growing from RA synovial tissue. Serum Hsp70 levels were increased in Systemic sclerosis patients, and associated with pulmonary fibrosis, skin sclerosis, renal vascular damage, oxidative stress, and inflammation.

Poids moléculaire: 94 kDa (MW of target protein)