TGIF1 anticorps (C-Term)

N° du produit ABIN630855

Détail du produit anti-TGIF1 anticorps

Antigène: TGIF1 (TGFB-Induced Factor Homeobox 1 (TGIF1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TGIF1 est non-conjugé

Application: Western Blotting (WB)

Specificité: TGIF1 antibody was raised against the C terminal of TGIF1

Purification: Affinity purified

Immunogène: TGIF1 antibody was raised using the C terminal of TGIF1 corresponding to a region with amino acids GQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TGIF1 Blocking Peptide, catalog no. 33R-3506, is also available for use as a blocking control in assays to test for specificity of this TGIF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGIF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TGIF1

Antigène: TGIF1 (TGFB-Induced Factor Homeobox 1 (TGIF1))

Autre désignation: TGIF1 (TGIF1 Produits)

Synonymes: anticorps HPE4, anticorps TGIF, anticorps AA959811, anticorps AI462167, anticorps Tgif, anticorps Tfig, anticorps fa06h05, anticorps fb33g11, anticorps zgc:55852, anticorps wu:fa06h05, anticorps wu:fb33g11, anticorps hpe4, anticorps tgif, anticorps tgif1, anticorps TGFB induced factor homeobox 1, anticorps TGFB-induced factor homeobox 1, anticorps TGFB induced factor homeobox 1 S homeolog, anticorps TGIF1, anticorps Tgif1, anticorps tgif1, anticorps tgif1.S

Sujet: TGIF1 is a member of the three-amino acid loop extension (TALE) superclass of atypical homeodomains. TALE homeobox proteins are highly conserved transcription regulators. This particular homeodomain binds to a previously characterized retinoid X receptor responsive element from the cellular retinol-binding protein II promoter. In addition to its role in inhibiting 9-cis-retinoic acid-dependent RXR alpha transcription activation of the retinoic acid responsive element, the protein is an active transcriptional co-repressor of SMAD2 and may participate in the transmission of nuclear signals during development and in the adult. Mutations in this gene are associated with holoprosencephaly type 4, which is a structural anomaly of the brain.

Poids moléculaire: 43 kDa (MW of target protein)

Pathways: Retinoic Acid Receptor Signaling Pathway, Chromatin Binding, Tube Formation