NEK11 anticorps

N° du produit ABIN630865

Détail du produit anti-NEK11 anticorps

Antigène: NEK11 (NIMA (Never In Mitosis Gene A)-Related Kinase 11 (NEK11))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NEK11 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: NEK11 antibody was raised using a synthetic peptide corresponding to a region with amino acids KEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NEK11 Blocking Peptide, catalog no. 33R-4339, is also available for use as a blocking control in assays to test for specificity of this NEK11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEK11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NEK11

Antigène: NEK11 (NIMA (Never In Mitosis Gene A)-Related Kinase 11 (NEK11))

Autre désignation: NEK11 (NEK11 Produits)

Synonymes: anticorps nek11, anticorps MGC147549, anticorps 4932416N14Rik, anticorps NIMA-related kinase 11, anticorps NIMA (never in mitosis gene a)-related expressed kinase 11, anticorps NIMA related kinase 11, anticorps nek11, anticorps Nek11, anticorps NEK11

Sujet: NEK11 is a member of the never in mitosis gene A family of kinases. NEK11 localizes to the nucleoli, and may function with NEK2A in the S-phase checkpoint. It appears to play roles in DNA replication and response to genotoxic stress. NEK11 belongs to the NIMA family of kinases, which are involved in DNA replication and genotoxic stress responses.

Poids moléculaire: 74 kDa (MW of target protein)