POLR3B anticorps (C-Term)

N° du produit ABIN630870

Détail du produit anti-POLR3B anticorps

Antigène: POLR3B (Polymerase (RNA) III (DNA Directed) Polypeptide B (POLR3B))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POLR3B est non-conjugé

Application: Western Blotting (WB)

Specificité: POLR3 B antibody was raised against the C terminal of POLR3

Purification: Affinity purified

Immunogène: POLR3 B antibody was raised using the C terminal of POLR3 corresponding to a region with amino acids IEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POLR3B Blocking Peptide, catalog no. 33R-3943, is also available for use as a blocking control in assays to test for specificity of this POLR3B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POLR3B

Antigène: POLR3B (Polymerase (RNA) III (DNA Directed) Polypeptide B (POLR3B))

Autre désignation: POLR3B (POLR3B Produits)

Synonymes: anticorps RGD1565311, anticorps C128, anticorps HLD8, anticorps RPC2, anticorps 2700078H01Rik, anticorps A330032P03Rik, anticorps C85372, anticorps RNA polymerase III subunit B, anticorps polymerase (RNA) III (DNA directed) polypeptide B, anticorps Polr3b, anticorps POLR3B

Sujet: POLR3B belongs to the RNA polymerase beta chain family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3B is the second largest core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. It is proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol III is composed of mobile elements and RPC2 is part of the core element with the central large cleft and probably a clamp element that moves to open and close the cleft.

Poids moléculaire: 128 kDa (MW of target protein)