Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

GAPDH anticorps (Middle Region)

Il existe 3+ publications pour ce produit. L’anticorps anti-GAPDH Polyclonal Lapin est utilisé pour la détection de GAPDH dans des échantillons de Humain et Souris. Il a été validé pour WB.
N° du produit ABIN630875
-15% Promotion 2026
1.035,41 €
1.218,13 €
Économisez 182,72 € (-15 %)
Plus frais de livraison 40,00 € et TVA
100 μL
Destination: France
Envoi sous 13 à 16 jours ouvrables

Aperçu rapide pour GAPDH anticorps (Middle Region) (ABIN630875)

Antigène

Voir toutes GAPDH Anticorps
GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))

Reactivité

  • 249
  • 170
  • 150
  • 65
  • 58
  • 46
  • 45
  • 34
  • 30
  • 28
  • 25
  • 22
  • 19
  • 15
  • 15
  • 14
  • 12
  • 9
  • 9
  • 6
  • 4
  • 4
  • 4
  • 4
  • 4
  • 4
  • 3
  • 3
  • 2
  • 2
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Humain, Souris

Hôte

  • 191
  • 93
  • 16
  • 9
  • 4
Lapin

Clonalité

  • 187
  • 124
Polyclonal

Conjugué

  • 173
  • 32
  • 20
  • 16
  • 5
  • 5
  • 5
  • 5
  • 5
  • 5
  • 3
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Cet anticorp GAPDH est non-conjugé

Application

  • 257
  • 103
  • 95
  • 95
  • 55
  • 55
  • 50
  • 36
  • 16
  • 16
  • 15
  • 15
  • 7
  • 6
  • 5
  • 4
  • 3
  • 3
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Western Blotting (WB)
  • Épitope

    • 34
    • 24
    • 13
    • 12
    • 8
    • 7
    • 6
    • 6
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Middle Region

    Specificité

    GAPDH antibody was raised against the middle region of GAPDH

    Purification

    Affinity purified

    Immunogène

    GAPDH antibody was raised using the middle region of GAPDH corresponding to a region with amino acids KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC
  • Indications d'application

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Commentaires

    GAPDH Blocking Peptide, (ABIN939625), is also available for use as a blocking control in assays to test for specificity of this GAPDH antibody

    Restrictions

    For Research Use only
  • Format

    Lyophilized

    Reconstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAPDH antibody in PBS

    Concentration

    Lot specific

    Buffer

    PBS

    Conseil sur la manipulation

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Stock

    4 °C/-20 °C

    Stockage commentaire

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Kuroda, Ishii, Uematsu, Ohata, Coban, Akira, Aritake, Urade, Morimoto: "Silica crystals and aluminum salts regulate the production of prostaglandin in macrophages via NALP3 inflammasome-independent mechanisms." dans: Immunity, Vol. 34, Issue 4, pp. 514-26, (2011) (PubMed).

    Shi, Zhang, Yang, Zhang, Wei: "ROCK1 plays an essential role in the transition from cardiac hypertrophy to failure in mice." dans: Journal of molecular and cellular cardiology, Vol. 49, Issue 5, pp. 819-28, (2010) (PubMed).

    Matsumoto, Takahashi, Shiva, Kawanishi, Kremenik, Kato, Yano: "The reduction of voluntary physical activity after poly I:C injection is independent of the effect of poly I:C-induced interferon-beta in mice." dans: Physiology & behavior, Vol. 93, Issue 4-5, pp. 835-41, (2008) (PubMed).

  • Antigène

    GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))

    Autre désignation

    GAPDH

    Sujet

    GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD).

    Poids moléculaire

    36 kDa (MW of target protein)
Vous êtes ici:
Chat with us!