Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

GAPDH anticorps (Middle Region)

GAPDH Reactivité: Humain, Souris WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN630875
  • Antigène Voir toutes GAPDH Anticorps
    GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))
    Épitope
    • 33
    • 21
    • 13
    • 9
    • 7
    • 6
    • 6
    • 5
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Middle Region
    Reactivité
    • 201
    • 138
    • 131
    • 69
    • 63
    • 53
    • 36
    • 27
    • 22
    • 20
    • 19
    • 19
    • 17
    • 16
    • 11
    • 11
    • 11
    • 9
    • 9
    • 8
    • 6
    • 4
    • 4
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Humain, Souris
    Hôte
    • 154
    • 89
    • 17
    • 9
    • 4
    Lapin
    Clonalité
    • 178
    • 93
    Polyclonal
    Conjugué
    • 145
    • 33
    • 21
    • 16
    • 5
    • 5
    • 5
    • 5
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp GAPDH est non-conjugé
    Application
    • 221
    • 88
    • 69
    • 64
    • 43
    • 37
    • 29
    • 23
    • 16
    • 16
    • 15
    • 14
    • 6
    • 6
    • 5
    • 4
    • 4
    • 3
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Specificité
    GAPDH antibody was raised against the middle region of GAPDH
    Purification
    Affinity purified
    Immunogène
    GAPDH antibody was raised using the middle region of GAPDH corresponding to a region with amino acids KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC
    Top Product
    Discover our top product GAPDH Anticorps primaire
  • Indications d'application
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Commentaires

    GAPDH Blocking Peptide, catalog no. 33R-4239, is also available for use as a blocking control in assays to test for specificity of this GAPDH antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAPDH antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Conseil sur la manipulation
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Kuroda, Ishii, Uematsu, Ohata, Coban, Akira, Aritake, Urade, Morimoto: "Silica crystals and aluminum salts regulate the production of prostaglandin in macrophages via NALP3 inflammasome-independent mechanisms." dans: Immunity, Vol. 34, Issue 4, pp. 514-26, (2011) (PubMed).

    Shi, Zhang, Yang, Zhang, Wei: "ROCK1 plays an essential role in the transition from cardiac hypertrophy to failure in mice." dans: Journal of molecular and cellular cardiology, Vol. 49, Issue 5, pp. 819-28, (2010) (PubMed).

    Matsumoto, Takahashi, Shiva, Kawanishi, Kremenik, Kato, Yano: "The reduction of voluntary physical activity after poly I:C injection is independent of the effect of poly I:C-induced interferon-beta in mice." dans: Physiology & behavior, Vol. 93, Issue 4-5, pp. 835-41, (2008) (PubMed).

  • Antigène
    GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))
    Autre désignation
    GAPDH (GAPDH Produits)
    Synonymes
    anticorps G3PD, anticorps GAPD, anticorps Gapd, anticorps BEST:GH12586, anticorps CG12055, anticorps Dmel\\CG12055, anticorps GA3PDH, anticorps GADPH, anticorps GAP, anticorps GAPDH, anticorps GAPDH I, anticorps GAPDH-1, anticorps GAPDH1, anticorps GAPDHI, anticorps Gapdh, anticorps Gapdh-1, anticorps Gapdh43E, anticorps gadph, anticorps gapdh, anticorps gapdh-1, anticorps gh12586, anticorps cb609, anticorps gapd, anticorps mg:bb02e05, anticorps wu:fb33a10, anticorps wu:ft80f05, anticorps KNC-NDS6, anticorps g3pd, anticorps G3PDH, anticorps glyceraldehyde-3-phosphate dehydrogenase, anticorps Glyceraldehyde 3 phosphate dehydrogenase 1, anticorps glyceraldehyde-3-phosphate dehydrogenase S homeolog, anticorps glyceraldehyde-3-phosphate dehydrogenase, type I, anticorps olfactory receptor 8K3, anticorps GAPDH, anticorps Gapdh, anticorps Gapdh1, anticorps gapdh, anticorps gapdh.S, anticorps gapDH, anticorps LOC100404960, anticorps LOC614985
    Sujet
    GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD).
    Poids moléculaire
    36 kDa (MW of target protein)
Vous êtes ici:
Support technique