MEMO1 anticorps (Middle Region)

N° du produit ABIN630881

Détail du produit anti-MEMO1 anticorps

Antigène: MEMO1 (Mediator of Cell Motility 1 (MEMO1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MEMO1 est non-conjugé

Application: Western Blotting (WB)

Specificité: MEMO1 antibody was raised against the middle region of MEMO1

Purification: Affinity purified

Immunogène: MEMO1 antibody was raised using the middle region of MEMO1 corresponding to a region with amino acids AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MEMO1 Blocking Peptide, catalog no. 33R-1386, is also available for use as a blocking control in assays to test for specificity of this MEMO1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MEMO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MEMO1

Antigène: MEMO1 (Mediator of Cell Motility 1 (MEMO1))

Autre désignation: MEMO1 (MEMO1 Produits)

Synonymes: anticorps MGC89105, anticorps C2orf4, anticorps MEMO, anticorps NS5ATP7, anticorps 0610016J10Rik, anticorps D930048L02Rik, anticorps RGD1309929, anticorps fi04d12, anticorps wu:fi04d12, anticorps zgc:55290, anticorps mediator of cell motility 1, anticorps mediator of cell motility 1 L homeolog, anticorps MEMO1, anticorps memo1, anticorps Memo1, anticorps memo1.L

Sujet: MEMO1 may control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. MEMO1 is the mediator of ERBB2 signaling. MEMO1 is required for breast carcinoma cell migration.

Poids moléculaire: 34 kDa (MW of target protein)