ACADVL anticorps (N-Term)
-
- Antigène Voir toutes ACADVL Anticorps
- ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACADVL est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ACADVL antibody was raised against the N terminal of ACADVL
- Purification
- Affinity purified
- Immunogène
- ACADVL antibody was raised using the N terminal of ACADVL corresponding to a region with amino acids RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV
- Top Product
- Discover our top product ACADVL Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACADVL Blocking Peptide, catalog no. 33R-8111, is also available for use as a blocking control in assays to test for specificity of this ACADVL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADVL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))
- Autre désignation
- ACADVL (ACADVL Produits)
- Sujet
- ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy.
- Poids moléculaire
- 64 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling, Monocarboxylic Acid Catabolic Process
-