ACADVL anticorps (N-Term)

N° du produit ABIN630886

Détail du produit anti-ACADVL anticorps

Antigène: ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACADVL est non-conjugé

Application: Western Blotting (WB)

Specificité: ACADVL antibody was raised against the N terminal of ACADVL

Purification: Affinity purified

Immunogène: ACADVL antibody was raised using the N terminal of ACADVL corresponding to a region with amino acids RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACADVL Blocking Peptide, catalog no. 33R-8111, is also available for use as a blocking control in assays to test for specificity of this ACADVL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADVL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACADVL

Antigène: ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))

Autre désignation: ACADVL (ACADVL Produits)

Sujet: ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy.

Poids moléculaire: 64 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling, Monocarboxylic Acid Catabolic Process