NMT1 anticorps (N-Term)

N° du produit ABIN630887

Détail du produit anti-NMT1 anticorps

Antigène: NMT1 (N-Myristoyltransferase 1 (NMT1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NMT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: NMT1 antibody was raised against the N terminal of NMT1

Purification: Affinity purified

Immunogène: NMT1 antibody was raised using the N terminal of NMT1 corresponding to a region with amino acids TMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NMT1 Blocking Peptide, catalog no. 33R-9200, is also available for use as a blocking control in assays to test for specificity of this NMT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NMT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NMT1

Antigène: NMT1 (N-Myristoyltransferase 1 (NMT1))

Autre désignation: NMT1 (NMT1 Produits)

Synonymes: anticorps NMT, anticorps im:2601337, anticorps nmt1, anticorps wu:fc15d01, anticorps wu:fc18a04, anticorps zgc:110714, anticorps MGC145283, anticorps AW536594, anticorps ARABIDOPSIS THALIANA MYRISTOYL-COA:PROTEIN N-MYRISTOYLTRANSFERASE, anticorps ATNMT1, anticorps MHM17.15, anticorps MHM17_15, anticorps N-MYRISTOYLTRANSFERASE 1, anticorps myristoyl-CoA:protein N-myristoyltransferase, anticorps N-myristoyltransferase 1, anticorps N-myristoyltransferase 1a, anticorps N-myristoyltransferase 1 L homeolog, anticorps N-myristoyltransferase 1 (predicted), anticorps myristoyl-CoA:protein N-myristoyltransferase, anticorps NMT1, anticorps nmt1a, anticorps nmt1.L, anticorps nmt1, anticorps SPBC2G2.11, anticorps Nmt1

Sujet: Myristate, a rare 14-carbon saturated fatty acid, is cotranslationally attached by an amide linkage to the N-terminal glycine residue of cellular and viral proteins with diverse functions. N-myristoyltransferase catalyzes the transfer of myristate from CoA to proteins. N-myristoylation appears to be irreversible and is required for full expression of the biologic activities of several N-myristoylated proteins, including the alpha subunit of the signal-transducing guanine nucleotide-binding protein (G protein) GO (GNAO1).

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling