MBP anticorps (Middle Region)

N° du produit ABIN630897

Cet anticorps anti-MBP est un anticorps Lapin Polyclonal détectant MBP dans WB. Adapté pour Humain et Rat.

Aperçu rapide pour MBP anticorps (Middle Region) (ABIN630897)

Antigène: MBP (Myelin Basic Protein (MBP))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MBP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MBP anticorps

Épitope: Middle Region

Specificité: MBP antibody was raised against the middle region of MBP

Purification: Affinity purified

Immunogène: MBP antibody was raised using the middle region of MBP corresponding to a region with amino acids FKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MBP Blocking Peptide, (ABIN938331), is also available for use as a blocking control in assays to test for specificity of this MBP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MBP

Antigène: MBP (Myelin Basic Protein (MBP))

Autre désignation: Myelin basic protein

Sujet: The classic group of MBP isoforms (isoform 4-isoform 14) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells.

Poids moléculaire: 33 kDa (MW of target protein)