MBP anticorps (Middle Region)
-
- Antigène Voir toutes MBP Anticorps
- MBP (Myelin Basic Protein (MBP))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MBP est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MBP antibody was raised against the middle region of MBP
- Purification
- Affinity purified
- Immunogène
- MBP antibody was raised using the middle region of MBP corresponding to a region with amino acids FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIV
- Top Product
- Discover our top product MBP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MBP Blocking Peptide, catalog no. 33R-2903, is also available for use as a blocking control in assays to test for specificity of this MBP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MBP (Myelin Basic Protein (MBP))
- Autre désignation
- Myelin basic protein (MBP Produits)
- Synonymes
- anticorps C76307, anticorps Hmbpr, anticorps R75289, anticorps golli-mbp, anticorps mld, anticorps shi, anticorps Mbps, anticorps cb274, anticorps fj33b11, anticorps mbp, anticorps wu:fj33b11, anticorps wu:fq15b02, anticorps zgc:136630, anticorps MGC115135, anticorps myelin basic protein, anticorps myelin basic protein a, anticorps myelin basic protein L homeolog, anticorps MBP, anticorps Mbp, anticorps mbpa, anticorps mbp, anticorps mbp.L
- Sujet
- The classic group of MBP isoforms (isoform 4-isoform 14) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells.
- Poids moléculaire
- 33 kDa (MW of target protein)
-