PEX5 anticorps (N-Term)

N° du produit ABIN630915

Détail du produit anti-PEX5 anticorps

Antigène: PEX5 (Peroxisomal Biogenesis Factor 5 (PEX5))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PEX5 est non-conjugé

Application: Western Blotting (WB)

Specificité: PEX5 antibody was raised against the N terminal of PEX5

Purification: Affinity purified

Immunogène: PEX5 antibody was raised using the N terminal of PEX5 corresponding to a region with amino acids TATDRWYDEYHPEEDLQHTASDFVAKVDDPKLANSEFLKFVRQIGEGQVS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PEX5 Blocking Peptide, catalog no. 33R-8985, is also available for use as a blocking control in assays to test for specificity of this PEX5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PEX5

Antigène: PEX5 (Peroxisomal Biogenesis Factor 5 (PEX5))

Autre désignation: PEX5 (PEX5 Produits)

Synonymes: anticorps AW212715, anticorps ESTM1, anticorps PTS1R, anticorps Pxr1, anticorps X83306, anticorps PTS1-BP, anticorps PBD2A, anticorps PBD2B, anticorps PXR1, anticorps Peroxin-5, anticorps peroxisomal biogenesis factor 5, anticorps pex5, anticorps Pex5, anticorps PEX5

Sujet: PEX5 binds to the C-terminal PTS1-type tripeptide peroxisomal targeting signal (SKL-type) and plays an essential role in peroxisomal protein import. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function.

Poids moléculaire: 70 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process