FKBP5 anticorps (C-Term)

N° du produit ABIN630950

L’anticorps Lapin Polyclonal anti-FKBP5 a été validé pour WB. Il convient pour détecter FKBP5 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour FKBP5 anticorps (C-Term) (ABIN630950)

Antigène: FKBP5 (FK506 Binding Protein 5 (FKBP5))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FKBP5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FKBP5 anticorps

Épitope: C-Term

Specificité: FKBP5 antibody was raised against the C terminal of FKBP5

Purification: Affinity purified

Immunogène: FKBP5 antibody was raised using the C terminal of FKBP5 corresponding to a region with amino acids CYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FKBP5 Blocking Peptide, (ABIN937220), is also available for use as a blocking control in assays to test for specificity of this FKBP5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FKBP5

Antigène: FKBP5 (FK506 Binding Protein 5 (FKBP5))

Autre désignation: FKBP5

Sujet: FKBP5 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. It is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein.

Poids moléculaire: 51 kDa (MW of target protein)