FKBP5 anticorps (C-Term)

N° du produit ABIN630950

Détail du produit anti-FKBP5 anticorps

Antigène: FKBP5 (FK506 Binding Protein 5 (FKBP5))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FKBP5 est non-conjugé

Application: Western Blotting (WB)

Specificité: FKBP5 antibody was raised against the C terminal of FKBP5

Purification: Affinity purified

Immunogène: FKBP5 antibody was raised using the C terminal of FKBP5 corresponding to a region with amino acids CYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FKBP5 Blocking Peptide, catalog no. 33R-1834, is also available for use as a blocking control in assays to test for specificity of this FKBP5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FKBP5

Antigène: FKBP5 (FK506 Binding Protein 5 (FKBP5))

Autre désignation: FKBP5 (FKBP5 Produits)

Synonymes: anticorps FKBP5, anticorps FKBP-5, anticorps AIG6, anticorps FKBP51, anticorps FKBP54, anticorps P54, anticorps PPIase, anticorps Ptg-10, anticorps D17Ertd592e, anticorps Dit1, anticorps si:zc263a23.8, anticorps wu:fc31g11, anticorps wu:fl87b03, anticorps zgc:64082, anticorps FK506 binding protein 5, anticorps FKBP5, anticorps fkbp5, anticorps Fkbp5

Sujet: FKBP5 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. It is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein.

Poids moléculaire: 51 kDa (MW of target protein)