HMGCS1 anticorps
-
- Antigène Voir toutes HMGCS1 Anticorps
- HMGCS1 (3-Hydroxy-3-Methylglutaryl-CoA Synthase 1 (Soluble) (HMGCS1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HMGCS1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- HMGCS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA
- Top Product
- Discover our top product HMGCS1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HMGCS1 Blocking Peptide, catalog no. 33R-4286, is also available for use as a blocking control in assays to test for specificity of this HMGCS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMGCS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HMGCS1 (3-Hydroxy-3-Methylglutaryl-CoA Synthase 1 (Soluble) (HMGCS1))
- Autre désignation
- HMGCS1 (HMGCS1 Produits)
- Synonymes
- anticorps HMGCS, anticorps zgc:56481, anticorps B130032C06Rik, anticorps 3-hydroxy-3-methylglutaryl-CoA synthase 1, anticorps 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble), anticorps 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1, anticorps 3-hydroxy-3-methylglutaryl coenzyme A synthase, anticorps hydroxymethylglutaryl-CoA synthase, anticorps 3-hydroxy-3-methylglutaryl-CoA synthase, anticorps hydroxymethylglutaryl coenzyme A synthase, anticorps 3-hydroxy-3-methylglutaryl-CoA synthase 1 S homeolog, anticorps HMGCS1, anticorps hmgcs1, anticorps Hmgcs1, anticorps mvaS, anticorps SAS2432, anticorps SZO_RS04705, anticorps SEQ_1109, anticorps NAEGRDRAFT_77778, anticorps hmgcs1.S
- Sujet
- This enzyme condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.
- Poids moléculaire
- 57 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha
-