FLJ11730 (N-Term) anticorps

N° du produit ABIN630964

Cet anticorps Lapin Polyclonal détecte spécifiquement dans IHC et WB. Il présente une réactivité envers Humain.

Aperçu rapide pour FLJ11730 (N-Term) anticorps (ABIN630964)

Antigène: FLJ11730

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Détail du produit

Épitope: N-Term

Specificité: FLJ11730 antibody was raised against the N terminal Of Flj11730

Purification: Affinity purified

Immunogène: FLJ11730 antibody was raised using the N terminal Of Flj11730 corresponding to a region with amino acids HNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQM

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FLJ11730 Blocking Peptide, (ABIN939187), is also available for use as a blocking control in assays to test for specificity of this FLJ11730 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ11730 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: FLJ11730

Sujet: The screening of cDNA expression libraries from human tumors with serum antibody (SEREX) has proven to be a powerful method for identifying the repertoire of tumor antigens recognised by the immune system of cancer patients, referred to as the cancer immunome. In this regard, cancer/testis (CT) antigens are of particular interest because of their immunogenicity and restricted expression patterns. Synoivial sarcomas are striking with regard to CT antigen expression, however, highly expressed in sarcoma, CT antigens do not induce frequent humoral immune responses in sarcoma patients. Sera from two patients were used to immunoscreen cDNA libraries from two synovial sarcoma cell lines and normal testis, resulting in the identification of 113 distinct antigens. Sarcoma antigen NY-SAR-91 is one of them.

Poids moléculaire: 23 kDa (MW of target protein)