CNN2 anticorps (N-Term)
-
- Antigène Voir toutes CNN2 Anticorps
- CNN2 (Calponin 2 (CNN2))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CNN2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Calponin 2 antibody was raised against the N terminal of CNN2
- Purification
- Affinity purified
- Immunogène
- Calponin 2 antibody was raised using the N terminal of CNN2 corresponding to a region with amino acids MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDF
- Top Product
- Discover our top product CNN2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Calponin 2 Blocking Peptide, catalog no. 33R-6515, is also available for use as a blocking control in assays to test for specificity of this Calponin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CNN2 (Calponin 2 (CNN2))
- Autre désignation
- Calponin 2 (CNN2 Produits)
- Synonymes
- anticorps Calponin-2, anticorps CNN2, anticorps DKFZp468N0916, anticorps cnn2, anticorps AA408047, anticorps AI324678, anticorps Calpo2, anticorps wu:fb36d03, anticorps wu:fb93a05, anticorps wz2414, anticorps zgc:65794, anticorps MGC82320, anticorps MGC108411, anticorps calponin 2, anticorps calponin 2 L homeolog, anticorps calponin 2 pseudogene, anticorps CNN2, anticorps cnn2, anticorps Cnn2, anticorps cnn2.L, anticorps LOC450419
- Sujet
- CNN2, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. CNN2 could play a role in smooth muscle contraction and cell adhesion.
- Poids moléculaire
- 34 kDa (MW of target protein)
-