MRPS12 anticorps (N-Term)

N° du produit ABIN630980

Détail du produit anti-MRPS12 anticorps

Antigène: MRPS12 (Mitochondrial Ribosomal Protein S12 (MRPS12))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MRPS12 est non-conjugé

Application: Western Blotting (WB)

Specificité: MRPS12 antibody was raised against the N terminal of MRPS12

Purification: Affinity purified

Immunogène: MRPS12 antibody was raised using the N terminal of MRPS12 corresponding to a region with amino acids LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRK

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MRPS12 Blocking Peptide, catalog no. 33R-5533, is also available for use as a blocking control in assays to test for specificity of this MRPS12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPS12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MRPS12

Antigène: MRPS12 (Mitochondrial Ribosomal Protein S12 (MRPS12))

Autre désignation: MRPS12 (MRPS12 Produits)

Synonymes: anticorps MPR-S12, anticorps MT-RPS12, anticorps RPMS12, anticorps RPS12, anticorps RPSM12, anticorps AI327385, anticorps Rpms12, anticorps rps12, anticorps CG7925, anticorps Dmel\\CG7925, anticorps EG:BACH59J11.1, anticorps MRP-S12, anticorps MRPS12, anticorps S12, anticorps Tko, anticorps l(1)3Ab, anticorps l(1)tko, anticorps mRpS12, anticorps mt-rps12, anticorps MGC64304, anticorps GB10531, anticorps mitochondrial ribosomal protein S12, anticorps technical knockout, anticorps mitochondrial ribosomal protein S12 L homeolog, anticorps 40S ribosomal protein S12, mitochondrial, anticorps putative mitochondrial 37S ribosomal protein MRPS12, anticorps fragile site, aphidicolin type, common, fra(6)(p22.2), anticorps MRPS12, anticorps Mrps12, anticorps tko, anticorps mrps12.L, anticorps LOC409723, anticorps mRpS12, anticorps mrps12, anticorps CAALFM_C106070WA, anticorps mrpS12, anticorps FRA6C

Sujet: Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPS12 is the 28S subunit protein that belongs to the ribosomal protein S12P family. The protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion.

Poids moléculaire: 12 kDa (MW of target protein)

Pathways: Sensory Perception of Sound