WARS2 anticorps (Middle Region)

N° du produit ABIN630987

Cet anticorps anti-WARS2 est un anticorps Lapin Polyclonal détectant WARS2 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour WARS2 anticorps (Middle Region) (ABIN630987)

Antigène: WARS2 (Tryptophanyl tRNA Synthetase 2, Mitochondrial (WARS2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WARS2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-WARS2 anticorps

Épitope: Middle Region

Specificité: WARS2 antibody was raised against the middle region of WARS2

Purification: Affinity purified

Immunogène: WARS2 antibody was raised using the middle region of WARS2 corresponding to a region with amino acids TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WARS2 Blocking Peptide, (ABIN5616987), is also available for use as a blocking control in assays to test for specificity of this WARS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WARS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WARS2

Antigène: WARS2 (Tryptophanyl tRNA Synthetase 2, Mitochondrial (WARS2))

Autre désignation: WARS2

Sujet: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. WARS2 is the mitochondrial tryptophanyl-tRNA synthetase.

Poids moléculaire: 24 kDa (MW of target protein)