Prohibitin 2 anticorps (C-Term)

N° du produit ABIN630990

Cet anticorps anti-Prohibitin 2 est un anticorps Lapin Polyclonal détectant Prohibitin 2 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour Prohibitin 2 anticorps (C-Term) (ABIN630990)

Antigène: Prohibitin 2 (PHB2)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Prohibitin 2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Prohibitin 2 anticorps

Épitope: C-Term

Specificité: Prohibitin 2 antibody was raised against the C terminal of PHB2

Purification: Affinity purified

Immunogène: Prohibitin 2 antibody was raised using the C terminal of PHB2 corresponding to a region with amino acids KLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Prohibitin 2 Blocking Peptide, (ABIN939919), is also available for use as a blocking control in assays to test for specificity of this Prohibitin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Prohibitin 2

Antigène: Prohibitin 2 (PHB2)

Autre désignation: Prohibitin 2

Sujet: PHB2 acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases (By similarity). It functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. PHB2 competes with NCOA1 for modulation of ER transcriptional activity. It probably involved in regulating mitochondrial respiration activity and in aging.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling