Lamin B2 anticorps (N-Term)

N° du produit ABIN630994

Détail du produit anti-Lamin B2 anticorps

Antigène: Lamin B2 (LMNB2)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Lamin B2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Lamin B2 antibody was raised against the N terminal of LMNB2

Purification: Affinity purified

Immunogène: Lamin B2 antibody was raised using the N terminal of LMNB2 corresponding to a region with amino acids MATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELE

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Lamin B2 Blocking Peptide, catalog no. 33R-5781, is also available for use as a blocking control in assays to test for specificity of this Lamin B2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMNB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Lamin B2

Antigène: Lamin B2 (LMNB2)

Autre désignation: Lamin B2 (LMNB2 Produits)

Synonymes: anticorps lmnb2-a, anticorps LMNB2, anticorps lmn2, anticorps lamb2, anticorps Lamin-L(II), anticorps LOC100136040, anticorps im:7142331, anticorps lamin, anticorps wu:fb94e05, anticorps wu:fb95e12, anticorps wu:fc15d06, anticorps wu:fc49h03, anticorps lamin-b2, anticorps lmnb2, anticorps LAMB2, anticorps LMN2, anticorps RGD1563803, anticorps lamin B2 S homeolog, anticorps lamin B2, anticorps lamin B2 L homeolog, anticorps lmnb2.S, anticorps LMNB2, anticorps lmnb2, anticorps lmnb2.L, anticorps Lmnb2

Sujet: The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. LMNB2 is one of the two B type proteins, B2.

Poids moléculaire: 68 kDa (MW of target protein)

Pathways: Apoptose, Caspase Cascade in Apoptosis