ACO2 anticorps (Middle Region)

N° du produit ABIN631019

Détail du produit anti-ACO2 anticorps

Antigène: ACO2 (Aconitase 2, Mitochondrial (ACO2))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACO2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ACO2 antibody was raised against the middle region of ACO2

Purification: Affinity purified

Immunogène: ACO2 antibody was raised using the middle region of ACO2 corresponding to a region with amino acids RYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHET

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACO2 Blocking Peptide, catalog no. 33R-8284, is also available for use as a blocking control in assays to test for specificity of this ACO2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACO2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACO2

Antigène: ACO2 (Aconitase 2, Mitochondrial (ACO2))

Autre désignation: ACO2 (ACO2 Produits)

Synonymes: anticorps DDBDRAFT_0206187, anticorps DDBDRAFT_0230168, anticorps DDB_0206187, anticorps DDB_0230168, anticorps aconitase 2, anticorps F10M23.310, anticorps F10M23_310, anticorps ACONM, anticorps ICRD, anticorps Aco-2, anticorps Aco3, anticorps D10Wsu183e, anticorps cb1017, anticorps wu:fa10e03, anticorps wu:fb69g04, anticorps wu:fc20c11, anticorps aconitase 2, anticorps aconitase 2 S homeolog, anticorps aconitate hydratase, mitochondrial, anticorps aconitase, mitochondrial, anticorps mitochondrial aconitate hydratase, anticorps aconitase 2, mitochondrial, anticorps Probable aconitate hydratase, mitochondrial, anticorps ACO2, anticorps aco2.S, anticorps Bm1_07420, anticorps aco2, anticorps ach1, anticorps Aco2, anticorps aco-2

Sujet: ACO2 belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.

Poids moléculaire: 82 kDa (MW of target protein)