ACO2 anticorps (Middle Region)
-
- Antigène Voir toutes ACO2 Anticorps
- ACO2 (Aconitase 2, Mitochondrial (ACO2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris, C. elegans
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACO2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ACO2 antibody was raised against the middle region of ACO2
- Purification
- Affinity purified
- Immunogène
- ACO2 antibody was raised using the middle region of ACO2 corresponding to a region with amino acids RYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHET
- Top Product
- Discover our top product ACO2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACO2 Blocking Peptide, catalog no. 33R-8284, is also available for use as a blocking control in assays to test for specificity of this ACO2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACO2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACO2 (Aconitase 2, Mitochondrial (ACO2))
- Autre désignation
- ACO2 (ACO2 Produits)
- Synonymes
- anticorps DDBDRAFT_0206187, anticorps DDBDRAFT_0230168, anticorps DDB_0206187, anticorps DDB_0230168, anticorps aconitase 2, anticorps F10M23.310, anticorps F10M23_310, anticorps ACONM, anticorps ICRD, anticorps Aco-2, anticorps Aco3, anticorps D10Wsu183e, anticorps cb1017, anticorps wu:fa10e03, anticorps wu:fb69g04, anticorps wu:fc20c11, anticorps aconitase 2, anticorps aconitase 2 S homeolog, anticorps aconitate hydratase, mitochondrial, anticorps aconitase, mitochondrial, anticorps mitochondrial aconitate hydratase, anticorps aconitase 2, mitochondrial, anticorps Probable aconitate hydratase, mitochondrial, anticorps ACO2, anticorps aco2.S, anticorps Bm1_07420, anticorps aco2, anticorps ach1, anticorps Aco2, anticorps aco-2
- Sujet
- ACO2 belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.
- Poids moléculaire
- 82 kDa (MW of target protein)
-