P5CS anticorps (N-Term)

N° du produit ABIN631032

Cet anticorps anti-P5CS est un anticorps Lapin Polyclonal détectant P5CS dans WB. Adapté pour Humain.

Aperçu rapide pour P5CS anticorps (N-Term) (ABIN631032)

Antigène: P5CS (ALDH18A1) (Aldehyde Dehydrogenase 18 Family, Member A1 (ALDH18A1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp P5CS est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-P5CS anticorps

Épitope: N-Term

Specificité: ALDH18 A1 antibody was raised against the N terminal of ALDH18 1

Purification: Affinity purified

Immunogène: ALDH18 A1 antibody was raised using the N terminal of ALDH18 1 corresponding to a region with amino acids SVIRHVRSWSNIPFITVPLSRTHGKSFAHRSELKHAKRIVVKLGSAVVTR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALDH18A1 Blocking Peptide, (ABIN5612007), is also available for use as a blocking control in assays to test for specificity of this ALDH18A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur P5CS

Antigène: P5CS (ALDH18A1) (Aldehyde Dehydrogenase 18 Family, Member A1 (ALDH18A1))

Autre désignation: ALDH18A1

Sujet: This gene is a member of the aldehyde dehydrogenase family and encodes a bifunctional ATP- and NADPH-dependent mitochondrial enzyme with both gamma-glutamyl kinase and gamma-glutamyl phosphate reductase activities. The encoded protein catalyzes the reduction of glutamate to delta1-pyrroline-5-carboxylate, a critical step in the de novo biosynthesis of proline, ornithine and arginine. Mutations in this gene lead to hyperammonemia, hypoornithinemia, hypocitrullinemia, hypoargininemia and hypoprolinemia and may be associated with neurodegeneration, cataracts and connective tissue diseases.

Poids moléculaire: 87 kDa (MW of target protein)