Monoamine Oxidase A anticorps (N-Term)
-
- Antigène Voir toutes Monoamine Oxidase A (MAOA) Anticorps
- Monoamine Oxidase A (MAOA)
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Monoamine Oxidase A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MAOA antibody was raised against the N terminal of MAOA
- Purification
- Affinity purified
- Immunogène
- MAOA antibody was raised using the N terminal of MAOA corresponding to a region with amino acids GPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
- Top Product
- Discover our top product MAOA Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MAOA Blocking Peptide, catalog no. 33R-3485, is also available for use as a blocking control in assays to test for specificity of this MAOA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAOA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Monoamine Oxidase A (MAOA)
- Autre désignation
- MAOA (MAOA Produits)
- Synonymes
- anticorps MAO-A, anticorps 1110061B18Rik, anticorps AA407771, anticorps Mao, anticorps MAOA, anticorps LOC100221249, anticorps Z-MAO, anticorps maob, anticorps moa, anticorps wu:fb68b05, anticorps wu:fo76d11, anticorps wu:fq38g06, anticorps zgc:85761, anticorps monoamine oxidase A, anticorps monoamine oxidase A L homeolog, anticorps amine oxidase [flavin-containing] A, anticorps monoamine oxidase, anticorps MAOA, anticorps Maoa, anticorps maoa.L, anticorps mll3668, anticorps maoa, anticorps LOC100221249, anticorps mao
- Sujet
- MAOA catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.
- Poids moléculaire
- 60 kDa (MW of target protein)
-