Medium-Chain Specific Acyl-CoA Dehydrogenase, Mitochondrial (MCAD) (N-Term) anticorps

N° du produit ABIN631056

Cet anticorps anti-Medium-Chain Specific Acyl-CoA Dehydrogenase, Mitochondrial Polyclonal Lapin (ABIN631056) détecte spécifiquement Medium-Chain Specific Acyl-CoA Dehydrogenase, Mitochondrial dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour Medium-Chain Specific Acyl-CoA Dehydrogenase, Mitochondrial (MCAD) (N-Term) anticorps (ABIN631056)

Antigène: Medium-Chain Specific Acyl-CoA Dehydrogenase, Mitochondrial (MCAD)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Détail du produit

Épitope: N-Term

Specificité: ACADM antibody was raised against the N terminal of ACADM

Purification: Affinity purified

Immunogène: ACADM antibody was raised using the N terminal of ACADM corresponding to a region with amino acids AAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQAT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACADM Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this ACADM antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Medium-Chain Specific Acyl-CoA Dehydrogenase, Mitochondrial (MCAD)

Autre désignation: ACADM

Sujet: ACADM Is the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Clinical phenotypes are associated with ACADM hereditary deficiency.

Poids moléculaire: 46 kDa (MW of target protein)