HADHB anticorps
-
- Antigène Voir toutes HADHB Anticorps
- HADHB (Hydroxyacyl-CoA Dehydrogenase/3-Ketoacyl-CoA Thiolase/enoyl-CoA Hydratase (Trifunctional Protein), beta Subunit (HADHB))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HADHB est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogène
- HADHB antibody was raised using a synthetic peptide corresponding to a region with amino acids LLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAE
- Top Product
- Discover our top product HADHB Anticorps primaire
-
-
- Indications d'application
-
WB: 0.2-1 µg/mL, IHC: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HADHB Blocking Peptide, catalog no. 33R-5158, is also available for use as a blocking control in assays to test for specificity of this HADHB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HADHB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HADHB (Hydroxyacyl-CoA Dehydrogenase/3-Ketoacyl-CoA Thiolase/enoyl-CoA Hydratase (Trifunctional Protein), beta Subunit (HADHB))
- Autre désignation
- HADHB (HADHB Produits)
- Synonymes
- anticorps ECHB, anticorps MTPB, anticorps TP-BETA, anticorps thiolase, anticorps fb14g10, anticorps wu:fb14g10, anticorps zgc:56274, anticorps 4930479F15Rik, anticorps Mtpb, anticorps Hadhb, anticorps hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta, anticorps hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta S homeolog, anticorps hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), beta subunit, anticorps hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit, anticorps HADHB, anticorps hadhb.S, anticorps Hadhb, anticorps hadhb
- Sujet
- HADHB is the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the beta subunit catalyzing the 3-ketoacyl-CoA thiolase activity. Mutations in HADHB gene result in trifunctional protein deficiency. The protein can also bind RNA and decreases the stability of some mRNAs.
- Poids moléculaire
- 47 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-