HADHB anticorps

N° du produit ABIN631070

L’anticorps anti-HADHB Polyclonal Lapin est utilisé pour la détection de HADHB dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB et IHC.

Aperçu rapide pour HADHB anticorps (ABIN631070)

Antigène: HADHB (Hydroxyacyl-CoA Dehydrogenase/3-Ketoacyl-CoA Thiolase/enoyl-CoA Hydratase (Trifunctional Protein), beta Subunit (HADHB))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HADHB est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-HADHB anticorps

Purification: Affinity purified

Immunogène: HADHB antibody was raised using a synthetic peptide corresponding to a region with amino acids LLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAE

Information d'application

Indications d'application: WB: 0.2-1 µg/mL, IHC: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HADHB Blocking Peptide, (ABIN940544), is also available for use as a blocking control in assays to test for specificity of this HADHB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HADHB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HADHB

Antigène: HADHB (Hydroxyacyl-CoA Dehydrogenase/3-Ketoacyl-CoA Thiolase/enoyl-CoA Hydratase (Trifunctional Protein), beta Subunit (HADHB))

Autre désignation: HADHB

Sujet: HADHB is the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the beta subunit catalyzing the 3-ketoacyl-CoA thiolase activity. Mutations in HADHB gene result in trifunctional protein deficiency. The protein can also bind RNA and decreases the stability of some mRNAs.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process