DLAT anticorps (C-Term)

N° du produit ABIN631076

L’anticorps Lapin Polyclonal anti-DLAT a été validé pour WB. Il convient pour détecter DLAT dans des échantillons de Humain, Souris, Rat et C. elegans.

Aperçu rapide pour DLAT anticorps (C-Term) (ABIN631076)

Antigène: DLAT (Dihydrolipoyl Transacetylase (DLAT))

Reactivité: Humain, Souris, Rat, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DLAT est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DLAT anticorps

Épitope: C-Term

Specificité: DLAT antibody was raised against the C terminal of DLAT

Purification: Affinity purified

Immunogène: DLAT antibody was raised using the C terminal of DLAT corresponding to a region with amino acids DVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DLAT Blocking Peptide, (ABIN937613), is also available for use as a blocking control in assays to test for specificity of this DLAT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DLAT

Antigène: DLAT (Dihydrolipoyl Transacetylase (DLAT))

Autre désignation: DLAT

Sujet: DLAT is dihydrolipoamide acetyltransferase, the E2 subunit of the mammalian pyruvate dehydrogenase complex of the inner mitochondrial membrane. Patients with primary biliary cirrhosis show autoantibodies to DLAT.

Poids moléculaire: 69 kDa (MW of target protein)