beta Actin anticorps (Middle Region)

N° du produit ABIN631092

Cet anticorps anti-beta Actin Polyclonal Lapin (ABIN631092) détecte spécifiquement beta Actin dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris, Rat, Chien, Drosophila melanogaster et C. elegans.

Aperçu rapide pour beta Actin anticorps (Middle Region) (ABIN631092)

Antigène: beta Actin (ACTB) (Actin, beta (ACTB))

Reactivité: Humain, Souris, Rat, Chien, Drosophila melanogaster, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp beta Actin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-beta Actin anticorps

Épitope: Middle Region

Specificité: Beta Actin antibody was raised against the middle region of ACTB

Purification: Affinity purified

Immunogène: beta Actin antibody was raised using the middle region of ACTB corresponding to a region with amino acids TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Beta Actin Blocking Peptide, (ABIN5612316), is also available for use as a blocking control in assays to test for specificity of this Beta Actin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur beta Actin

Antigène: beta Actin (ACTB) (Actin, beta (ACTB))

Autre désignation: beta Actin

Sujet: This protein is one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Cell-Cell Junction Organization, Maintenance of Protein Location, Phototransduction