PACRG anticorps (Middle Region)

N° du produit ABIN631123

Détail du produit anti-PACRG anticorps

Antigène: PACRG (PARK2 Co-Regulated (PACRG))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PACRG est non-conjugé

Application: Western Blotting (WB)

Specificité: PACRG antibody was raised against the middle region of PACRG

Purification: Affinity purified

Immunogène: PACRG antibody was raised using the middle region of PACRG corresponding to a region with amino acids GAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PACRG Blocking Peptide, catalog no. 33R-3157, is also available for use as a blocking control in assays to test for specificity of this PACRG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PACRG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PACRG

Antigène: PACRG (PARK2 Co-Regulated (PACRG))

Autre désignation: PACRG (PACRG Produits)

Synonymes: anticorps PACRG, anticorps GLUP, anticorps HAK005771, anticorps PARK2CRG, anticorps RP3-495O10.2, anticorps zgc:101786, anticorps RGD1561027, anticorps 1700008H23Rik, anticorps parkin coregulated, anticorps PARK2 co-regulated, anticorps PARK2 coregulated, anticorps PACRG, anticorps pacrg, anticorps Pacrg

Sujet: PACRG is a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy.

Poids moléculaire: 33 kDa (MW of target protein)