PACRG anticorps (Middle Region)

N° du produit ABIN631123

Cet anticorps Lapin Polyclonal détecte spécifiquement PACRG dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PACRG anticorps (Middle Region) (ABIN631123)

Antigène: PACRG (PARK2 Co-Regulated (PACRG))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PACRG est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PACRG anticorps

Épitope: Middle Region

Specificité: PACRG antibody was raised against the middle region of PACRG

Purification: Affinity purified

Immunogène: PACRG antibody was raised using the middle region of PACRG corresponding to a region with amino acids GAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PACRG Blocking Peptide, (ABIN938543), is also available for use as a blocking control in assays to test for specificity of this PACRG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PACRG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PACRG

Antigène: PACRG (PARK2 Co-Regulated (PACRG))

Autre désignation: PACRG

Sujet: PACRG is a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy.

Poids moléculaire: 33 kDa (MW of target protein)