LIN7C anticorps

N° du produit ABIN631151

L’anticorps anti-LIN7C Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de LIN7C dans des échantillons provenant de Humain, Rat et Souris. }

Aperçu rapide pour LIN7C anticorps (ABIN631151)

Antigène: LIN7C (Lin-7 Homolog C (LIN7C))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LIN7C est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LIN7C anticorps

Purification: Affinity purified

Immunogène: LIN7 C antibody was raised using a synthetic peptide corresponding to a region with amino acids MGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LIN7C Blocking Peptide, (ABIN5614459), is also available for use as a blocking control in assays to test for specificity of this LIN7C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIN0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LIN7C

Antigène: LIN7C (Lin-7 Homolog C (LIN7C))

Autre désignation: LIN7C

Sujet: LIN7C plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. It forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Synaptic Membrane