GAMT anticorps (N-Term)
-
- Antigène Voir toutes GAMT Anticorps
- GAMT (Guanidinoacetate N-Methyltransferase (GAMT))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GAMT est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GAMT antibody was raised against the N terminal of GAMT
- Purification
- Affinity purified
- Immunogène
- GAMT antibody was raised using the N terminal of GAMT corresponding to a region with amino acids MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYM
- Top Product
- Discover our top product GAMT Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GAMT Blocking Peptide, catalog no. 33R-6399, is also available for use as a blocking control in assays to test for specificity of this GAMT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAMT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GAMT (Guanidinoacetate N-Methyltransferase (GAMT))
- Autre désignation
- GAMT (GAMT Produits)
- Synonymes
- anticorps gamt, anticorps zgc:123136, anticorps CCDS2, anticorps PIG2, anticorps TP53I2, anticorps AA571402, anticorps Spintz1, anticorps MGC75698, anticorps GAMT, anticorps GMT, anticorps guanidinoacetate N-methyltransferase L homeolog, anticorps guanidinoacetate N-methyltransferase S homeolog, anticorps guanidinoacetate N-methyltransferase, anticorps guanidinoacetate methyltransferase, anticorps gamt.L, anticorps gamt.S, anticorps gamt, anticorps GAMT, anticorps Gamt
- Sujet
- GAMT is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in its gene have been implicated in neurologic syndromes and muscular hypotonia, probably due to creatine deficiency and accumulation of guanidinoacetate in the brain of affected individuals.
- Poids moléculaire
- 26 kDa (MW of target protein)
-