CA8 anticorps (Middle Region)
-
- Antigène Voir toutes CA8 Anticorps
- CA8 (Carbonic Anhydrase VIII (CA8))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CA8 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Carbonic Anhydrase VIII antibody was raised against the middle region of CA8
- Purification
- Affinity purified
- Immunogène
- Carbonic Anhydrase VIII antibody was raised using the middle region of CA8 corresponding to a region with amino acids TISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
- Top Product
- Discover our top product CA8 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Carbonic Anhydrase VIII Blocking Peptide, catalog no. 33R-9129, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase VIII antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CA8 (Carbonic Anhydrase VIII (CA8))
- Autre désignation
- Carbonic Anhydrase VIII (CA8 Produits)
- Synonymes
- anticorps AW546993, anticorps Ca8, anticorps Cals, anticorps Cals1, anticorps Carp, anticorps wdl, anticorps zgc:110118, anticorps CA-VIII, anticorps CALS, anticorps CAMRQ3, anticorps CARP, anticorps carbonic anhydrase 8, anticorps carbonic anhydrase VIII, anticorps CAH8, anticorps Car8, anticorps ca8, anticorps CA8
- Sujet
- CA8 was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, CA8 lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). CA8 continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family.
- Poids moléculaire
- 33 kDa (MW of target protein)
-