MTPN anticorps (Middle Region)

N° du produit ABIN631163

L’anticorps Lapin Polyclonal anti-MTPN a été validé pour WB. Il convient pour détecter MTPN dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour MTPN anticorps (Middle Region) (ABIN631163)

Antigène: MTPN (Myotrophin (MTPN))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MTPN est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MTPN anticorps

Épitope: Middle Region

Specificité: Myotrophin antibody was raised against the middle region of MTPN

Purification: Affinity purified

Immunogène: Myotrophin antibody was raised using the middle region of MTPN corresponding to a region with amino acids GRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Myotrophin Blocking Peptide, (ABIN938920), is also available for use as a blocking control in assays to test for specificity of this Myotrophin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTPN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MTPN

Antigène: MTPN (Myotrophin (MTPN))

Autre désignation: Myotrophin

Sujet: MTPN has a potential role in cerebellar morphogenesis. MTPN may function in differentiation of cerebellar neurons, particularly of granule cells. MTPN seems to be associated with cardiac hypertrophy.

Poids moléculaire: 13 kDa (MW of target protein)