GLUD1 anticorps (N-Term)

N° du produit ABIN631170

Détail du produit anti-GLUD1 anticorps

Antigène: GLUD1 (Glutamate Dehydrogenase 1 (GLUD1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GLUD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GLUD1 antibody was raised against the N terminal of GLUD1

Purification: Affinity purified

Immunogène: GLUD1 antibody was raised using the N terminal of GLUD1 corresponding to a region with amino acids AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GLUD1 Blocking Peptide, catalog no. 33R-1287, is also available for use as a blocking control in assays to test for specificity of this GLUD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLUD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GLUD1

Antigène: GLUD1 (Glutamate Dehydrogenase 1 (GLUD1))

Autre désignation: GLUD1 (GLUD1 Produits)

Synonymes: anticorps GDH, anticorps gdh1, anticorps GDH 1, anticorps glud1, anticorps GLUD1, anticorps cb719, anticorps wu:fb16e02, anticorps wu:fb58f12, anticorps wu:fe37f03, anticorps wu:fj43f02, anticorps zgc:192851, anticorps zgc:55630, anticorps GDH1, anticorps GLUD, anticorps AI118167, anticorps Gdh-X, anticorps Glud, anticorps Gludl, anticorps Ac2-281, anticorps Gdh1, anticorps Gludeha, anticorps MRG-2, anticorps GLUTAMATE DECARBOXYLASE 1, anticorps GLUTAMATE DEHYDROGENASE 1, anticorps MRG7.13, anticorps MRG7_13, anticorps glutamate dehydrogenase 1, anticorps C2H1orf130, anticorps legdh1, anticorps cb622, anticorps wu:fc33g09, anticorps wu:fc66a10, anticorps zgc:77186, anticorps glutamate dehydrogenase 1, anticorps glutamate dehydrogenase 1 S homeolog, anticorps glutamate dehydrogenase 1, mitochondrial, anticorps glutamate dehydrogenase 1b, anticorps glutamate dehydrogenase, anticorps non-compact myelin associated protein, anticorps glutamate dehydrogenase 1a, anticorps GLUD1, anticorps GDH1, anticorps glud1, anticorps glud1.S, anticorps LOC693461, anticorps glud1b, anticorps Glud1, anticorps HACJB3_RS00320, anticorps LOC100587725, anticorps NCMAP, anticorps gdh1, anticorps glud1a

Sujet: L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate. Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, L'effet Warburg