ACTR2 anticorps

N° du produit ABIN631175

L’anticorps Lapin Polyclonal anti-ACTR2 a été validé pour WB. Il convient pour détecter ACTR2 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ACTR2 anticorps (ABIN631175)

Antigène: ACTR2 (Actin-Related Protein 2 (ACTR2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACTR2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ACTR2 anticorps

Purification: Affinity purified

Immunogène: ACTR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACTR2 Blocking Peptide, (ABIN5611925), is also available for use as a blocking control in assays to test for specificity of this ACTR2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACTR2

Antigène: ACTR2 (Actin-Related Protein 2 (ACTR2))

Autre désignation: ACTR2

Sujet: ACTR2 is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion. The specific function of this gene has not yet been determined.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: Signalisation RTK, Regulation of Actin Filament Polymerization