SULT2B1 anticorps (N-Term)

N° du produit ABIN631181

L’anticorps anti-SULT2B1 Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de SULT2B1 dans des échantillons provenant de Humain. }

Aperçu rapide pour SULT2B1 anticorps (N-Term) (ABIN631181)

Antigène: SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1 (SULT2B1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SULT2B1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SULT2B1 anticorps

Épitope: N-Term

Specificité: SULT2 B1 antibody was raised against the N terminal of SULT2 1

Purification: Affinity purified

Immunogène: SULT2 B1 antibody was raised using the N terminal of SULT2 1 corresponding to a region with amino acids MASPPPFHSQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SULT2B1 Blocking Peptide, (ABIN5616456), is also available for use as a blocking control in assays to test for specificity of this SULT2B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SULT2B1

Antigène: SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1 (SULT2B1))

Autre désignation: SULT2B1

Sujet: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis