ABAT anticorps (Middle Region)

N° du produit ABIN631182

Cet anticorps anti-ABAT Polyclonal Lapin (ABIN631182) détecte spécifiquement ABAT dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour ABAT anticorps (Middle Region) (ABIN631182)

Antigène: ABAT (4-Aminobutyrate Aminotransferase (ABAT))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABAT est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ABAT anticorps

Épitope: Middle Region

Specificité: ABAT antibody was raised against the middle region of ABAT

Purification: Affinity purified

Immunogène: ABAT antibody was raised using the middle region of ABAT corresponding to a region with amino acids YRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABAT Blocking Peptide, (ABIN936206), is also available for use as a blocking control in assays to test for specificity of this ABAT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ABAT

Antigène: ABAT (4-Aminobutyrate Aminotransferase (ABAT))

Autre désignation: ABAT

Sujet: 4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde.

Poids moléculaire: 55 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process