UBR1 anticorps (N-Term)

N° du produit ABIN631210

Détail du produit anti-UBR1 anticorps

Antigène: UBR1 (Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBR1 est non-conjugé

Application: Western Blotting (WB)

Specificité: UBR1 antibody was raised against the N terminal of UBR1

Purification: Affinity purified

Immunogène: UBR1 antibody was raised using the N terminal of UBR1 corresponding to a region with amino acids YKQLQKEYISDDHDRSISITALSVQMFTVPTLARHLIEEQNVISVITETL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBR1 Blocking Peptide, catalog no. 33R-10155, is also available for use as a blocking control in assays to test for specificity of this UBR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBR1

Antigène: UBR1 (Ubiquitin Protein Ligase E3 Component N-Recognin 1 (UBR1))

Autre désignation: UBR1 (UBR1 Produits)

Sujet: UBR1 is an E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. recognises and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.

Poids moléculaire: 200 kDa (MW of target protein)