FECH anticorps

N° du produit ABIN631239

Cet anticorps anti-FECH Polyclonal Lapin (ABIN631239) détecte spécifiquement FECH dans WB et IHC. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour FECH anticorps (ABIN631239)

Antigène: FECH (Ferrochelatase (FECH))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FECH est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-FECH anticorps

Purification: Affinity purified

Immunogène: FECH antibody was raised using a synthetic peptide corresponding to a region with amino acids QHAQGAKPQVQPQKRYESNIRKPKTGILMLNMGGPETLGDVHDFLLRLFL

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FECH Blocking Peptide, (ABIN5613567), is also available for use as a blocking control in assays to test for specificity of this FECH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FECH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FECH

Antigène: FECH (Ferrochelatase (FECH))

Autre désignation: FECH

Sujet: Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis