WASF3 anticorps (N-Term)

N° du produit ABIN631248

Cet anticorps anti-WASF3 est un anticorps Lapin Polyclonal détectant WASF3 dans WB. Adapté pour Humain.

Aperçu rapide pour WASF3 anticorps (N-Term) (ABIN631248)

Antigène: WASF3 (WAS Protein Family, Member 3 (WASF3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WASF3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-WASF3 anticorps

Épitope: N-Term

Specificité: WASF3 antibody was raised against the N terminal of WASF3

Purification: Affinity purified

Immunogène: WASF3 antibody was raised using the N terminal of WASF3 corresponding to a region with amino acids NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WASF3 Blocking Peptide, (ABIN5616988), is also available for use as a blocking control in assays to test for specificity of this WASF3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WASF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WASF3

Antigène: WASF3 (WAS Protein Family, Member 3 (WASF3))

Autre désignation: WASF3

Sujet: WASF3 is a member of the Wiskott-Aldrich syndrome protein family. It is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function.

Poids moléculaire: 55 kDa (MW of target protein)

Pathways: Signalisation RTK