RAP1B anticorps (N-Term)

N° du produit ABIN631250

Détail du produit anti-RAP1B anticorps

Antigène: RAP1B (RAP1B, Member of RAS Oncogene Family (RAP1B))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAP1B est non-conjugé

Application: Western Blotting (WB)

Specificité: RAP1 B antibody was raised against the N terminal of RAP1

Purification: Affinity purified

Immunogène: RAP1 B antibody was raised using the N terminal of RAP1 corresponding to a region with amino acids MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAP1B Blocking Peptide, catalog no. 33R-6359, is also available for use as a blocking control in assays to test for specificity of this RAP1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAP1B

Antigène: RAP1B (RAP1B, Member of RAS Oncogene Family (RAP1B))

Autre désignation: RAP1B (RAP1B Produits)

Synonymes: anticorps K-REV, anticorps RAL1B, anticorps k-rev, anticorps ral1b, anticorps 2810443E11Rik, anticorps Rap1b, anticorps cb1026, anticorps cb119, anticorps sb:cb119, anticorps wu:fb11c04, anticorps wu:fb74e09, anticorps wu:fk70e05, anticorps RAP1B, member of RAS oncogene family, anticorps RAP1B, member of RAS oncogene family L homeolog, anticorps RAS related protein 1b, anticorps ras-related protein Rap-1b-like, anticorps RAP1B, anticorps Rap1b, anticorps rap1b.L, anticorps Bm1_39445, anticorps LOC109067672, anticorps rap1b

Sujet: RAP1B and RAP1A belong to a superfamily of RAS-like small GTP-binding proteins involved in cell signaling.

Poids moléculaire: 21 kDa (MW of target protein)

Pathways: CXCR4-mediated Signaling Events, Signaling of Hepatocyte Growth Factor Receptor