CSNK2A1/CK II alpha anticorps (Middle Region)

N° du produit ABIN631269

Détail du produit anti-CSNK2A1/CK II alpha anticorps

Antigène: CSNK2A1/CK II alpha (CSNK2A1) (Casein Kinase 2 alpha 1 (CSNK2A1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Drosophila melanogaster, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CSNK2A1/CK II alpha est non-conjugé

Application: Western Blotting (WB)

Specificité: CK2 alpha 1 antibody was raised against the middle region of CSNK2 A1

Purification: Affinity purified

Immunogène: CK2 alpha 1 antibody was raised using the middle region of CSNK2 A1 corresponding to a region with amino acids LGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CK2 alpha 1 Blocking Peptide, catalog no. 33R-4966, is also available for use as a blocking control in assays to test for specificity of this CK2 alpha 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CSNK2A1/CK II alpha

Antigène: CSNK2A1/CK II alpha (CSNK2A1) (Casein Kinase 2 alpha 1 (CSNK2A1))

Abstract: CSNK2A1 Produits

Synonymes: anticorps CK2A2, anticorps CSNK2A1, anticorps CK2A1, anticorps CKII, anticorps CSNK2A3, anticorps CK2A, anticorps Ck2a, anticorps BmCK2a, anticorps wu:fi38e04, anticorps wu:fi38h03, anticorps csnk2a1, anticorps CK-II, anticorps CK2, anticorps Ckiialpha, anticorps Csnk2a1-rs4, anticorps ck2a1, anticorps casein kinase 2 alpha 2, anticorps casein kinase 2 alpha 1, anticorps casein kinase 2 alpha subunit, anticorps casein kinase 2, alpha 1 polypeptide, anticorps CK2 protein kinase alpha 2, anticorps casein kinase II alpha subunit, anticorps Casein kinase II alpha subunit, anticorps casein kinase 2, alpha 1 polypeptide S homeolog, anticorps CSNK2A2, anticorps CSNK2A1, anticorps ck2a, anticorps Ck2a, anticorps csnk2a1, anticorps cka2, anticorps Ckiialpha, anticorps CK2A1, anticorps Csnk2a1, anticorps csnk2a1.S

Sujet: Casein kinase II is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. The kinase exists as a tetramer and is composed of an alpha, an alpha-prime, and two beta subunits. The alpha subunits contain the catalytic activity while the beta subunits undergo autophosphorylation. CSNK2A1 represents the alpha subunit.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome